PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00062g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 346aa    MW: 38740.7 Da    PI: 8.4385
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00062g00002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.12e-171050242
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                              +i+n++ r+ +f kRr g+lKKA+E+ +LCd++++ i++s+
  Peinf101Scf00062g00002.1 10 FINNDTERKASFKKRRRGLLKKAHEIKTLCDVDICAILYSP 50
                              89*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.502149IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-24296IPR002100Transcription factor, MADS-box
CDDcd002666.10E-28285No hitNo description
PRINTSPR004049.2E-11323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTRKKVKLAF INNDTERKAS FKKRRRGLLK KAHEIKTLCD VDICAILYSP YHCDPEVFPS  60
HDDVLETIKK FRELPEMEQT KKMMNQEGFL RQRIKKVDDQ IRKIRKENRI REFTNTMYEM  120
MGGQQLAGNM HPYDLNDLGF VISQRIKEAE AMLEELRKEG SVAVPQPSSG PVGPGGSNYP  180
KEPLAPGGTS YFQEPRAPLM VPPISVVPPV ADPSMVPPMA RPSFARPPPV PQPMHPPTLS  240
PLPMSPQTFP PMVSQMISPM PQPPKAPRVV PQTPPPVTFP MTPLLDSPMN PPVVESDYHQ  300
NNRYAFPDSP SLPEGMSFDD ALMNFVNGTT SSSIDQDPSS SNNKDV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFINNDTERKASFKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597191.12e-73PREDICTED: uncharacterized protein LOC104093177
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13291040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-41AGAMOUS-like 80